SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7460.XP_625267 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  7460.XP_625267
Domain Number - Region: 715-816
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00013
Family Calponin-homology domain, CH-domain 0.0064
Further Details:      
 
Domain Number - Region: 325-376
Classification Level Classification E-value
Superfamily PapD-like 0.000863
Family MSP-like 0.04
Further Details:      
 
Domain Number - Region: 819-854
Classification Level Classification E-value
Superfamily PapD-like 0.0471
Family MSP-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7460.XP_625267
Sequence length 1181
Comment (Apis mellifera)
Sequence
MESVREELNEDLRTINKHKQYVPMHMHDNSSSSSSEPSIDSDFNDIVRLCLHGETEVARL
FFQPDILYFGELYVGENSQRVVRISNPLKFAPLFCRYVRNASAHCYPETILLKPEGSTEV
LLKVRGKENINSSFKIYFDIAADSCESMKTRRQTKIKVGRYSIQCKVNVKLLVTTKQSCM
PRAISSFEEEYYKVVHIPKWKYEKVSETVKCYTSVKKLSTSTEVLIPLTPLQIYNVRMYP
TLFAFGMIVSRSRNLIILPPGVVATRLVEFRAYHIGKFNGYIDYIINDNHSFELGVTANI
VEKQLSLDTREITLGQDWLKEEIYRPMDCSIQIRNKLDAKTKFQWEIPSTSSFLVEPISG
IVRGNASLLIYIYYKPDFSRSTSTELIMKCENSGYNTIRINIPTSMPKVSFIKDIINIGE
IPLNLPTKTLAFLRNFEYVEIEFEIDSSSLVHGCIVRPLHGIMSPRAIATLEIYLTFSLC
FHFTMVIRVTIQKHLNLQLKIIGNVSYPQLKLQPQFLHLRRISASAYQHYLINATNVGTT
MLKLKFLLEEYPEFRVCLSSQRHDLGIGNKDIFIAPNTSQEFYLHFDPIDLASYAFYLPI
VINGIIGPVSISHPKSLKPSEHLKQFKGYYINMPNFILEKLPPTIVTMSIDCTKPGQFRT
IRKGPELGLVGVLESLLGPVIYNYIGKFCHKESENIIDNIHSKITDKSSDINYYSFEERL
LLAWLSYHYEEGRKQEWMTDFRVVLNPYENKDMAEARNIKNFDKDLSDSLVLHNAICVVN
AWRKIRLGFIISPLDIIYPNCVKMLMLVAYLYNILPTYIPKTTIKFSCPLSETVTRQINF
TNPTANNVGFLIQFFGNKHGFFTTILPQSVIHLTSHGTYLLLCGSTIGPHFGRNQTFILE
GQVDCLGIANEYTIYSKLYQAVDKILTINVPYENSIEYEIWASEERPTKPSTLKQTRWTE
LCLRKIPRRLFINQNSIIVKENKKAFLSVTVACLSPCHRSFWIIFQSKIGDFIIQINSHW
QSSLTDNIIIKWNEQIEKCICTEQNYNEMCPLNLIVPIPSRNKQLWSCVAHMFQKTLNPK
ERLFWTRYLDTHIGLRLIRWLMGNSTDSAAMEFNHIFDKKVTYNVTISDASHILKYPKTF
IINDVRPHAENTPINIHISPFIDRLCEIILTLVSINGNERR
Download sequence
Identical sequences 7460.XP_625267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]