SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_001177876 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_001177876
Domain Number 1 Region: 19-44
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000318
Family Calponin-homology domain, CH-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_001177876
Sequence length 70
Comment (Strongylocentrotus purpuratus)
Sequence
MAEKSDDSEKGGIYERSLRSNKDERDKIQKKTFTKWVNKHLKKVSRFFACFFHSRETILC
LSSLMWPSGA
Download sequence
Identical sequences 7668.XP_001177876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]