SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_001181960 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_001181960
Domain Number 1 Region: 17-78
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000393
Family HLH, helix-loop-helix DNA-binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 84-126
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000275
Family Hairy Orange domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_001181960
Sequence length 273
Comment (Strongylocentrotus purpuratus)
Sequence
MLTSSGYQQMDMCSNRPRTAKHLTERKRRARINDSLLQLKSMVFPVIKKDISRHPKMEKA
DILEMTVRYLKDVQTPEQGESKGQVTTYHAGFTECLSEVSTFMSNCESIDIETRLRLLGH
LADRCSTINDADQKPDVSRLQPAQTQQQQQQRVPSPVTVPQQQTRVAAPSPISIPATSPV
QQFATTPNGMVLLLPAHTVQHNSVISVRVPLSSDGVLTPPQSPMSPEPAMTRFTPSPVDI
KPSKNALNTKHHRFAPYQKHAIKATEKSMWRPW
Download sequence
Identical sequences W4Z0H3
XP_796692.1.5271 SPU_021608 7668.XP_001181960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]