SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_001183257 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  7668.XP_001183257
Domain Number - Region: 2-79
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00741
Family Calponin-homology domain, CH-domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_001183257
Sequence length 366
Comment (Strongylocentrotus purpuratus)
Sequence
MRDFSNGYLVAEIFSWYFPEDIQMHSYGNSGGLQGKLGNWSLLRTFFKKRGLEIPYELID
GTIHCRPDAAELLVQYLYTKLTNRKLKRLALDRDIDFTDHHYQQTLPIHARNTAAMAVKT
NLKITEFETEPNIITCQQKAQEIIRQHIQHRQEDRLEDPARFNIKPSIGQKCVRRPIPQT
PHSASQAKNSPQREYLIKESKLKRLALDRDIDFTDHHYQQTLPIHARNTAAMAVKTNLKI
TEFETEPNIITCQQKAQEIIRQHIQHRQEDRLEDPARFNIKPSIGQKCVRRPIPQTPHSA
SQAKNSPAQREYLIKENSNANPVQASSPSVHFKEIKVNQLDHVTQQVIRPTSMSPSNVLP
PISGRS
Download sequence
Identical sequences 7668.XP_001183257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]