SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_001191532 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_001191532
Domain Number 1 Region: 34-100
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000000074
Family Subtilase propeptides/inhibitors 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_001191532
Sequence length 102
Comment (Strongylocentrotus purpuratus)
Sequence
PGTMKFFAACMLSVIATAVALAPVYRVDEANDGVRGRYVIKIKDDVDDVDAVVDKLADLP
SFKLFQGKIYRRFYHAIKGFSARLSDELVFQLKAFIERNGMG
Download sequence
Identical sequences 7668.XP_001191532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]