SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_001192016 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_001192016
Domain Number 1 Region: 39-98,125-194
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.93e-27
Family Calponin-homology domain, CH-domain 0.0074
Further Details:      
 
Domain Number 2 Region: 295-335
Classification Level Classification E-value
Superfamily GAS2 domain-like 0.000000929
Family GAS2 domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_001192016
Sequence length 335
Comment (Strongylocentrotus purpuratus)
Sequence
MVAMDGLQTLHDERARFDNPYDDRYSSTWEGASLKPFRTKDEYLYAMREDLAEWLSNMYD
LEILPESFFDRLENGALLCQHANKVRREAIDYRLRNYPDNDDVEFVQGIFVKHDDLRYKL
DAKAGTFLARDNISNFIHWCRHSLRINEVLLFESDDLVLRKNDKSFILCLLEVARRGGPI
GMPVPMLVQLEQEIDRELEAGTPSEPDSFTSTEPASPSSETTTDAEPESEADSEGRPMEC
TSSPEPSPQRRGSLIPKTKPRSRRVSSKHHNQQEPQEDGGDPPKQIMLNDEVLKTLDELV
RAEVNRCSCPMQFPMIRIAEGKYRIGDSNTLIFVR
Download sequence
Identical sequences 7668.XP_001192016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]