SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_001193356 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_001193356
Domain Number 1 Region: 142-318
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-46
Family DBL homology domain (DH-domain) 0.00000885
Further Details:      
 
Domain Number 2 Region: 22-73
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000044
Family Calponin-homology domain, CH-domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_001193356
Sequence length 318
Comment (Strongylocentrotus purpuratus)
Sequence
QFIKPLKKILDRSDIDKIFLNIEFLCMKNIRTFLRACSRVFKIREADFFDPAWLFQMSNF
GSLIDLLSKLSQADDAIRMGAQPFKTEQEDIYGGLEDLADEHDLANEGDIYDTVDEDEGD
KIYDDLVNIRRELTSHRTQQRQSEPKTAKRDFCRTEIVETEGKYVEALSMLCEQFIKPLK
KILDRSDIDKIFLNIEELLRRHRGFLRDLEDAFRRPTPTMAHAFKKHKPDFLIYGFYCAH
MLGAQNHIEKVSNNPQIRAKIEEFERKANDRKFRLRDLLSVPMQRILKYHLLLKELVKST
DKQHTERKELDEALDEMQ
Download sequence
Identical sequences 7668.XP_001193356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]