SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_001194235 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_001194235
Domain Number 1 Region: 595-697
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000146
Family PDZ domain 0.014
Further Details:      
 
Domain Number 2 Region: 4-119
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000113
Family Calponin-homology domain, CH-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_001194235
Sequence length 1717
Comment (Strongylocentrotus purpuratus)
Sequence
MVDEVTYRDLTDPKDLQKSLLNGVLLCELLIAIKRGCVKRPNRFSNQENLKEFFRGCKEE
LGLDPSKEQIFSVDDLTSLSRRLSWVPSATSAPKTDREKLKSIVTTIYWISEAAVQLPSY
SGPKLDTYAFESVIFGIYSPRSPREEPKPDVKDRKGSETDSVFEDNTNSFLDLPEKIEYK
EPAWKTALKAAESEAPVKPSHGLDTESVPTKSQENPGDEPVAANGERTLSSDDADQVVLR
QPSAVRLRRMERKLGKKSGPPTSAKPHSRSLSLPEATDVLIMRQNALDSNHNSATYEDLD
DEDEEDSNMWRSSFKSWKMKRNEVASNVLERKAFREEVDTLEQNKDKKKPKTFREIVEEK
KRRENLLIKKSLKKELEKDEINAILTSVDLVDSDSEEEEEEDEIRAETRQEQHSQLEPVQ
EPYQQDQRASTLPMRGRRVSPATTAPHKPFPITASSTAPTSSKPPPSVAPKPKYRPSAGA
FQPYRRSQSLRDGVDYADGGDHHHTHTTSPSPTATTPSEESYPSSSFHEKMLRDREREKE
RAEAYKKSQEHARKPKPKRMSMGIMGRIAAFNSGDAFKKKEEEEEASSTASSARPAEPAQ
SQQETRSYVEHDITMQRRPRAQGGFGFTVTGGIDKKKPIVVKGIDPGSTAGSSALKIGDE
ITVINNERTKTFDQDDIQYSISQAVLSGHLILKVRRYDDDSNQLRSVSSSSSASSSSYQD
SSERRLEEERRRREEDEREEEQRREEQRRIEGERREEERRRVEERRREEERRREDERQRE
EERRREEERRKEEEERWREEQRMQEEEEMERQREEARRRREEEEEEERRLEEAIMSKLEQ
EEKEEDEREEVHRQIEEDERNKVGWSREKKFRNKKSDVDPANRRSFNLDEERQRLEKWQK
EQERIRQEQYEQEQRRLQDEQEKDLQRAEYESRRKQDMEQRALQERRRMLQKKAQQDLKK
REEEMLERERKERERRRLEQLEREEEEERRRREEERLQEEREERERVEREEREREEAARR
QEEELALVQRWKEKEKRAKEMEKQRIREDREARERKAREKIEKEREEYDRLLKEREEERE
CLAREQEERQRVAMEREERQREARVEDEKRAAKEREERQRAAKEREARLQAAVQQEEKAR
AKRPFADEAIRPQVQQHQESAPPPSRQHHQPDEDLLQRIREEERDRIRLEERDRLRMEWE
QLEQEKQEQLEKQRKEREEIEKLRREQAELQRERERLALQQQEELERLTKQRELYSKSMN
NVFDDEDVERKNSYNRRKQHGGSEEDLRKSHSSKPLGKEIMKGKMLPERDSQPGKSYMGK
YKDDNLPTEQHWLVEEAKRRQHGPLVAGKVINSLPIHPRTDSLDHEPVLEKKVYNQEHAA
PPPSSSSNHNNANIHEKDYVKNEPVGYEQEIPTRIPPPNRVQAVQGSAPRTKQPTHPHDE
PSPSSSDNTNRWDGPRHQYDNQPEFKHVQRRMHGAPALDAERKQKMHNRRSMPDLTKDPG
FAAPVTRIMDDQHIPRGPGGGGPAPRGVGPPSPHHGQQRGPPPPHHGGPGGDQRRQGPAS
ESLIQPHDHRRAGPKSPPAQVRANRGPPSSSSSPQGRGPPRQQQQPHPQRPPQQHAPGRG
PPGQRASAFQQPSKKPPPGRSVSGKVSCSNCSKSLGRGAAMIIESVGLHFHLECFRCCVC
NIQLGNGTKGTDVRIRASKLHCQNCYSNDAGFEFTEV
Download sequence
Identical sequences 7668.XP_001194235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]