SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_001196033 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_001196033
Domain Number 1 Region: 1-155
Classification Level Classification E-value
Superfamily YWTD domain 5.62e-20
Family YWTD domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_001196033
Sequence length 161
Comment (Strongylocentrotus purpuratus)
Sequence
PAGISIDEVSRTVYCAFKDSGKIVSIGIDGTGMKEVVTNPTEPRAVEASPTLGYLYFTHQ
YRLERCHFNGTSRQELFYSSALSDITGLSVDAIGGRIYISDIGQKVIKHMKLDGSDVITI
NPGSYEPSDVFLFRGILYFSDITTKSIVEYDFMGGYSQKAT
Download sequence
Identical sequences 7668.XP_001196033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]