SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_001198572 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_001198572
Domain Number 1 Region: 5-59
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000353
Family RING finger domain, C3HC4 0.0095
Further Details:      
 
Domain Number 2 Region: 87-144
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000504
Family B-box zinc-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_001198572
Sequence length 300
Comment (Strongylocentrotus purpuratus)
Sequence
MASCKKDHLMCPICIDIIKNATILNCGHTFCQGCLAKINYNVARRCLSCPVCRAETTCTK
GRSGIEGLPRNVIINSLVADYQMSLNSAKACPFHKEHEKEFFCLECKVHICVRCVVTRHL
NHPMETKEDFEREIQEKIDCLMQRGQAKKEDMEKVIASAEAPKAQVASAVVNLEHRIKNA
FARKSRLLKENETFLLEEIHMLQRSYNSIIDDDTMPYKQVVEDINRALTVITADDPGSLE
ADSLASHTMVCNDLDELLNKALAKIDAEVTGCVKEAVMNAEFHPLGDALLKLGMVKTKKN
Download sequence
Identical sequences W4XBG5
7668.XP_001198572 SPU_000713 XP_003730049.1.5271 XP_011666272.1.5271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]