SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_001202458 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_001202458
Domain Number 1 Region: 14-109
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000873
Family DNA topoisomerase II binding protein 1, TopBP1 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_001202458
Sequence length 116
Comment (Strongylocentrotus purpuratus)
Sequence
MNRSETVVVMAEFEGEIFDALSSNSRHILGTTAILQSAATDEHLPCVTRPLFCRHMDKLV
ICFTGFLDKAEIKRLVVLVHNMAGSIRKDYGPRVTHLVANSSNSEKYRVSGMMMFT
Download sequence
Identical sequences W4Y566
SPU_010861 XP_791060.1.5271 7668.XP_001202458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]