SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_001202473 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_001202473
Domain Number 1 Region: 72-135
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.0000000000183
Family Thyroglobulin type-1 domain 0.0016
Further Details:      
 
Domain Number 2 Region: 9-55
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.000000000536
Family Thyroglobulin type-1 domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_001202473
Sequence length 137
Comment (Strongylocentrotus purpuratus)
Sequence
RQYGTHNISCHALVEQTTANDSAYFPRCTGYNTYSAKQCDSSGSCWCVGPDGVHGADREM
EADRTKLCVEAPCRQELESNQDKVNLGQNLTSNPVCDPQGMYIPQQCTADGTQCWCSEPD
GTMIPNTKRASGESVTC
Download sequence
Identical sequences 7668.XP_001202473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]