SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_788398 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_788398
Domain Number 1 Region: 795-900
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.33e-31
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 
Weak hits

Sequence:  7668.XP_788398
Domain Number - Region: 159-233
Classification Level Classification E-value
Superfamily C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.00243
Family C-terminal domain of alpha and beta subunits of F1 ATP synthase 0.0033
Further Details:      
 
Domain Number - Region: 377-415
Classification Level Classification E-value
Superfamily LemA-like 0.0327
Family LemA-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_788398
Sequence length 902
Comment (Strongylocentrotus purpuratus)
Sequence
MTQAPLKNDANQQGWNEIQELLQQTQQENHFMRQQMEILRHENRVLKDRMKTIDSDTQVS
KTDSEKAILLGLDGNSGLEERVQGGAAEAVEESSTRDSSYIIADHTGELVLTGFPSSSSD
GSVVLPDEPSNMSDGNWDILSSDGEGSMANLHDRILQMEENHYTVNEELQATLQELKDLQ
DQVTDLTLDTDKLSEEKSMIIEALYRQMSKTEKMNMVVQHFKGICDEQKIDYNLEELNDS
SPRTAVSDQASGMARSKEEQEKLTILLKEHNSEIQSEVDKLKYQLLEMEGMLRGALAARK
SLEQEITVFKGKLSSLEVEREKGETLLRAEKDKINQLFRYSDPKGILDLPQLLEDGRLKT
DTAESRCEELARALEESNNHAEKLQEELERIEDEFESSKNHFEEQVERYQVMIRELDTEK
AELETELINLKETVIELEETVERQEYDKQQHLSTIADLNQAVQTLREEKQNMGRDLIDLK
RTSARDSEEWVQFQRDLQKAVVIANDYRNEAQNEVKMLEKDKGELHDQIKSLSAEVERLR
KIERTLKPPTPTSPAPPRSTPTENEIRQRMQAIMKSSEKDIVRGSTSRKTLSNGKVSVKN
IIKSLENNAGADAPKAPTSPTGTSPVPMNFTSNTRPPMERRNTTIAITKSMNSKPLYTRR
ATTTIITTHDAQKLSMSTSGRAIDDSMIGRSRSQPSNRNEARQMIGDALTRSRDFSTRRS
TPSGRDTSESPTARRAKSLCNEPISSGRRSSSSSSLRDSCDSPTPRDSVGNQSPTARKTT
EGVDPLSMLVKYEGGGSKRNALLKWCQARTHGYKGVEVTNFSSSWNDGLAFCAIIHSYMP
EMIPWNELNNQDKKRNFTVAFVAGESIEISSILDIDDMVRLERPDWKSVMTYVTALYKHF
ET
Download sequence
Identical sequences 7668.XP_788398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]