SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_790940 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_790940
Domain Number 1 Region: 2-46
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000012
Family EGF-type module 0.0085
Further Details:      
 
Weak hits

Sequence:  7668.XP_790940
Domain Number - Region: 46-96
Classification Level Classification E-value
Superfamily YWTD domain 0.000122
Family YWTD domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_790940
Sequence length 98
Comment (Strongylocentrotus purpuratus)
Sequence
MGTNSCGNNNGGCSHLCLYRPHGQICACPMGHELLADGKTCIVPEAFLLFLRTEDIRRIS
LETTYKDVEIPLSGIEEATALDFDILDNRIYWTDSKAK
Download sequence
Identical sequences 7668.XP_790940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]