SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_791706 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_791706
Domain Number 1 Region: 12-102
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.37e-16
Family Calponin-homology domain, CH-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_791706
Sequence length 106
Comment (Strongylocentrotus purpuratus)
Sequence
MIQNERDAFDTLFDHAPDKLNVVKKSLIAFANKHLNKLNLEVMDLDSQFHDGVFFILLMG
LLEGYYVPLHCYHMTPTTFEEKVHNVNLALDLMDDAGLPKAKARAE
Download sequence
Identical sequences 7668.XP_791706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]