SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_797562 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_797562
Domain Number 1 Region: 26-257
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-82
Family Calponin-homology domain, CH-domain 0.0000177
Further Details:      
 
Domain Number 2 Region: 275-398
Classification Level Classification E-value
Superfamily Spectrin repeat 6.91e-30
Family Spectrin repeat 0.00000321
Further Details:      
 
Domain Number 3 Region: 510-631
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-28
Family Spectrin repeat 0.0000269
Further Details:      
 
Domain Number 4 Region: 399-506
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-22
Family Spectrin repeat 0.0000161
Further Details:      
 
Domain Number 5 Region: 746-895
Classification Level Classification E-value
Superfamily EF-hand 1.16e-20
Family EF-hand modules in multidomain proteins 0.018
Further Details:      
 
Domain Number 6 Region: 634-746
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-19
Family Spectrin repeat 0.0000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_797562
Sequence length 899
Comment (Strongylocentrotus purpuratus)
Sequence
MAYYGNQDAYAYDDDDEDDYMKQEDEWNRDEVLDPAWERQQRKTFTAWCNSHLRKANANI
EEISSDFCNGLKLMMLLEVISSEKLPPPERGKMRFHKIANVNKALDFITSKGVRLVSIGA
EEIVDMNLKMILGMIWTIILRFAIQDISIEDHSAKEGLLLWCQRKTAPYRNVNIQNFHNS
WKDGLGFCALIHRHRPDLLDYSKLKKDDPATNLELAFSVAEKHLDIPRMLDAEDLMNTAR
PDDKSIMTYVSAYYHAFSGAQKAETAAGRINKVLGLNMENQRLMDEYEKLASDLLEWIRR
KKPWLEDRTLQESTLDAMQKKLDEFRTYRGKEKPPKTEDKARLETNFNTLQTKLQLTNRP
AYRPSEGKLVSDIAKAWKGLETSEKGFEDWLLAEMRRLERLDHLAKKFRHKCDIHEAWAA
GKEEILREDFSGMRLNDLKAKCRKHEAFESDLAAHQDRVEQIAAIAQEMNDLEYHAIGPI
NQRCQTICDQWDTLGSLSMGRSEALAKAVMILESIDSRQLDFAKKAAPFNNWLDGAREDL
MDMFIVHTLEEISELLDAHEVFKNNLGAAEEEFNSLAALANEINKTIEMNNVGIKENPYT
TLTVQVVVEKWRDLCELVPKRDEALSNELRRQQSNEQMRVRFAQLANQVGPWIEKQMAAT
MNIAIGLNVPLESQLHKLQDYEHTVLQYKSNVDDLESCNKSVQEAMIFENPHTQYTMETI
RVGWEQLLTAIRRYINEIENNILTRDTKGITEEQLNEFRASFNHFDKNRTQRLEPLEFRS
CLVSLGYDLREDKKSDIEFQRIMALVDPSGTGKVSFQSFLDFMTREMSDADTVEQVVDSF
KVLANGKAYILPDELRMELPPEQAEYCIARMAPFNGTGAAPGALDYMSFSSALYGQSEL
Download sequence
Identical sequences W4YYJ5
7668.XP_797562 SPU_020920 XP_797562.1.5271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]