SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7668.XP_798477 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7668.XP_798477
Domain Number 1 Region: 196-321
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000000288
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7668.XP_798477
Sequence length 477
Comment (Strongylocentrotus purpuratus)
Sequence
MLWGVSGVSKGSAAEAARDKSSQSSPASNNQKRSYTKTIYDLMAHLSGRLVPGIPINQAL
PGDPTERVLQLHWQHSTLLTFLRSQGAGVAGIKPEYLFEPQDYQRWMKLQEQVREKKKAM
QEGKSTVAITIEEEPLDEHLFESVSKRAWTDLLLQTIKVLVLARITPRQFRTLPSPGHVS
LPSINHDPLCSNIYSVGERILLSWLNHHYEHQRHNIWSNCDKGGVPPSRWVVNFDYDLLD
GLVLAAVIAAHVPFLIKTHLQGMYTHPSTAEQCLHNALKVVTAFRFIGLDYDIQAIDITD
PNPISLMLLCQHLYQRLPQYMPKTAVEFTTSLHSSVTRQVRLTNPSNKPLTYHAMVAGRD
ARDFTIPRGSQVMIQPKGKQDLPVIFTSRFLRPAEAVLVLVGRRVGAACGTTLVFNLKTA
IDNITPTATIKCESPCFELQKVDVAIVNPFDEAGEFRIVLVEAKTPFPGSDSKQKGL
Download sequence
Identical sequences 7668.XP_798477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]