SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 76869.PputGB1_0821 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  76869.PputGB1_0821
Domain Number 1 Region: 115-280
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 3.06e-59
Family NadC C-terminal domain-like 0.00000146
Further Details:      
 
Domain Number 2 Region: 11-114
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 1.58e-33
Family NadC N-terminal domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 76869.PputGB1_0821
Sequence length 282
Comment (Pseudomonas putida GB 1)
Sequence
MPNLRLADLTAEIEANVRRALLEDIGSGDITAQLIPAERLAKATIITREDCVIAGTAWVD
AVFRQLDPRVAVHWQVADGERATANQPLFHLEGPARSLLSGERSALNFLQMLSGVATRAR
FLADLVADTQVRLLDTRKTLPGLRLAQKYAVTCGGCDNHRIGLYDAFLIKENHIAASGGV
AQAVAAAHRIAPGKPVEIEVESLEELREALAAGADIIMLDELNLDEMREAVRINAGKAKL
EASGGVNETTLRVIAETGVDYISIGAMTKDVKAVDLSMRLSL
Download sequence
Identical sequences B0KPB2
WP_012270530.1.13892 WP_012270530.1.54657 WP_012270530.1.65540 WP_012270530.1.66485 WP_012270530.1.81634 gi|167031836|ref|YP_001667067.1| 76869.PputGB1_0821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]