SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7719.ENSCINP00000004847 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7719.ENSCINP00000004847
Domain Number 1 Region: 125-231
Classification Level Classification E-value
Superfamily EF-hand 1.07e-24
Family Osteonectin 0.013
Further Details:      
 
Domain Number 2 Region: 68-119
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000137
Family Ovomucoid domain III-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7719.ENSCINP00000004847
Sequence length 239
Comment (Ciona intestinalis)
Sequence
MNVKTVILAVLVVGICTLCGTAEAKKRKRSQQAKLDLLPDEKLCARKRCGRKPKGSWCQV
VRDENGHRTPTCVCPRSCNTTQIEPVCSMYGRQYDSECLMHLEACKKRKNIKLAYEGPCI
ASQAKCQSHELQQFPFRLLDWFVHLKDVDEFGSVDYQKTVMSLSETDRKDVAQWKFQHLD
RNKDGKLSNKEIKRFRFALMPLEHCAKHFFKKCDLDKNRKLSSDEWSECLVTRALTWYQ
Download sequence
Identical sequences 7719.ENSCINP00000004847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]