SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7719.ENSCINP00000006732 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7719.ENSCINP00000006732
Domain Number 1 Region: 161-299
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.17e-42
Family Calponin-homology domain, CH-domain 0.0005
Further Details:      
 
Domain Number 2 Region: 1167-1281
Classification Level Classification E-value
Superfamily E set domains 9.55e-36
Family Filamin repeat (rod domain) 0.00000891
Further Details:      
 
Domain Number 3 Region: 1569-1677
Classification Level Classification E-value
Superfamily E set domains 1.13e-32
Family Filamin repeat (rod domain) 0.0000347
Further Details:      
 
Domain Number 4 Region: 1645-1762
Classification Level Classification E-value
Superfamily E set domains 2.07e-32
Family Filamin repeat (rod domain) 0.0000128
Further Details:      
 
Domain Number 5 Region: 2390-2507
Classification Level Classification E-value
Superfamily E set domains 1.8e-30
Family Filamin repeat (rod domain) 0.0000457
Further Details:      
 
Domain Number 6 Region: 1465-1567
Classification Level Classification E-value
Superfamily E set domains 2.87e-30
Family Filamin repeat (rod domain) 0.0000319
Further Details:      
 
Domain Number 7 Region: 2168-2262
Classification Level Classification E-value
Superfamily E set domains 4.2e-30
Family Filamin repeat (rod domain) 0.0000721
Further Details:      
 
Domain Number 8 Region: 1985-2081
Classification Level Classification E-value
Superfamily E set domains 1.13e-29
Family Filamin repeat (rod domain) 0.0000206
Further Details:      
 
Domain Number 9 Region: 643-766
Classification Level Classification E-value
Superfamily E set domains 2e-29
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 
Domain Number 10 Region: 1752-1856
Classification Level Classification E-value
Superfamily E set domains 8.01e-29
Family Filamin repeat (rod domain) 0.00015
Further Details:      
 
Domain Number 11 Region: 973-1096
Classification Level Classification E-value
Superfamily E set domains 1.27e-28
Family Filamin repeat (rod domain) 0.00039
Further Details:      
 
Domain Number 12 Region: 8-104
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.7e-27
Family Calponin-homology domain, CH-domain 0.00047
Further Details:      
 
Domain Number 13 Region: 1270-1377
Classification Level Classification E-value
Superfamily E set domains 3e-26
Family Filamin repeat (rod domain) 0.00035
Further Details:      
 
Domain Number 14 Region: 1355-1476
Classification Level Classification E-value
Superfamily E set domains 2.87e-24
Family Filamin repeat (rod domain) 0.00012
Further Details:      
 
Domain Number 15 Region: 564-672
Classification Level Classification E-value
Superfamily E set domains 6.67e-24
Family Filamin repeat (rod domain) 0.0022
Further Details:      
 
Domain Number 16 Region: 421-514
Classification Level Classification E-value
Superfamily E set domains 1.27e-22
Family Filamin repeat (rod domain) 0.0015
Further Details:      
 
Domain Number 17 Region: 336-433
Classification Level Classification E-value
Superfamily E set domains 8.67e-22
Family Filamin repeat (rod domain) 0.0016
Further Details:      
 
Domain Number 18 Region: 863-935,965-1006
Classification Level Classification E-value
Superfamily E set domains 3.26e-20
Family Filamin repeat (rod domain) 0.0045
Further Details:      
 
Domain Number 19 Region: 1083-1185
Classification Level Classification E-value
Superfamily E set domains 9.59e-20
Family Filamin repeat (rod domain) 0.0019
Further Details:      
 
Domain Number 20 Region: 2096-2181
Classification Level Classification E-value
Superfamily E set domains 2.47e-17
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 21 Region: 771-855
Classification Level Classification E-value
Superfamily E set domains 8.67e-17
Family Filamin repeat (rod domain) 0.0047
Further Details:      
 
Domain Number 22 Region: 1923-1999
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000127
Family Filamin repeat (rod domain) 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7719.ENSCINP00000006732
Sequence length 2507
Comment (Ciona intestinalis)
Sequence
DNYDEDMPATERELAEDATWKIIQKNTFTRWCNEHLKCINKRVANLETDLSDGLRLIGLI
EILSQKKMGKHNKRPNFRQMRLENVSVALNFLEAERIKLVSIGKTFFRSVLCFGAVSIMR
AKQTSGQRGINAIISSLLAAGDSLWAIKLNLLSSIKGEPLKAIVDGNLKLILGLIWTLIL
HYSISMPMWDEEEEVEEKSKATPKQRLLGWIQNKVPQMPITNFKGNWQDGTALGALVDNC
APGLCPDWEDWDPNNPMENTAEAMKLADEWLGVPQVITPEEITNPHVDELSVMTYLSQFP
KATLKPGAPLRPKTNGKKARAYGKGSINVFLGIEPKGCKVGSPAPFTVETVSAGSGEVLV
YLTNPEGHKTELQATPNNDKLKTYSVTYYPDMPGDYEVTVMFAGVGIHKSPFKVYVDDSP
ADPSKVVAKGPGLLPGNIVNHPTHFDVITTDAGAGDVNVVIEDPTGCKQSVRPKIEKQGE
TYKVTYTPSKNGPHHVHVLFADAPINKSPFEVPISLRKSNILSCNKFHRTDPELVLEFND
SCVKKYSKDPPHTPPRCKDPTRSFNANACRAYGRGIQPTGLRMREKADFHVTTKDAGDAD
LKVTVKGPRGSNEPVTVKKNPKEPEVFDCEYYPLKQGNYTVDVTFGGKPIPKSPFEILVG
PEAGAQKVRAYGPGLHGGKVGHSADFVVETIGTEVGQLGINCTVNQWQVRFSIEGPSQAK
IECEDCGDGSCDVKYHPTEPGEYAVHVVCDDNDIKGSPFMAQIAPADTKSRPDMVKAYGP
GLESGTPVNGRPTNFTVDAKRAGAPAPVEVVAVAADGENLPVKVKDNGDGTYDCDYTPKN
PIKHTIIPSYDGVAVNVNEDSYPDKVKVYGPGVEPGLKAEEPTYFTVDCARAGNGDVSIG
IKCAAGVVGPTERDVEFEIIKNDASDTFTVKYTPPGPGGKLNIFFLFRYFKGDFQILLQY
FSKCFINIHTIMVLFAEQPVPKSPITVNVASSHNAKKVKADGPGIEKEGVECGKPTHFTI
YTKGAGKAKPNVQFKPARGSYKPPASKADILDNKDNTYTVSYTPHAEGPMDVEVTYGGDK
IPNSPFPVDVAPALDVNAVKVKGLEDKMDVGKPQEFEVLTKGAGGQGKLDVDVVGPSNLP
IHVHDKKTPNGKKCHFTPVEEGPHRVNVAYDGIPVRGSPFLVDALTPADPSKVRAYGPGL
SGGVVNQSAPFTIETADAGNGGLGLTVEGPCEAKIECIDNGDGSCSVAYMPTEAGDYKIN
VLFADKHIPGSPFNAKIEPAFDASKVDLSGPGLESGKVGKPSKIYADCCSAGEAPLTADV
LNDDGTKVPTKVKDNGDGTHDITFVPNKPGKALVNVQYGGISVPKSPVSVPIKPDVDTSG
VRTTGPGVQPDGVLADVEAEFQVDAGCLAPRGGKHVTAKAVGPSGTAVPVDLKDNRDGTY
DAKYSPYEKGPHQVIVDYDDVPVPGSPFNVGVDEGCDPTKVKAYGPGLEQGTTAKPAKFM
VDTRGAGTGGLGLVVEGPSDAKITCTDSKDGTCAVEYLPTAPGEYEVNITYGGENIPGSP
FIVPVKDTVDPTKVSCNGPGVSPGVRANVPQEFTVDCSTAGVAPLDVAVKGPKGLKEPVD
VRDNGDGTHTVKYTPTKEGPYQVQVKYADHEIPRSPYRVRVQPTHDASKVKCNGPGIASG
GVPASLPVEFTIDATDAGDGVLAVQITDPEGRPKRASVRDNGDGTYSVSYIPDTVGRYTI
SVKYGGDEIPYSPYRIRAVPSGDANKCLVSGDGLGPNIYIGEEAVITVDPNGAGPGNVTC
AVTTPDGEKLDADVVQNKDGTFDIFYTPKEVGPYTINIHFGGEEVPNSPYRVTVSNMVAW
VPFLPLVYRDASHKIKNDTHNIKIFFNLKCLLLLILIFTLKAIEQVDGPDSLRPVQLVFE
VPSRPGNLTSEVTTPSGIKESPVIKNNGDGTITVQYQPHEPGLHEMAILLDNEHISGSPI
QFYADVMAPGHVTAYGPGLVTGKVDEPANFTIVTKDAGAGGLALAVEGPSKADITCQDNK
DGTCSVTYLPTAPGEYTVTVKFDDQHIPGSPYTANISGGADQRKSKLSYGTTSDVALKIN
ESDLSLLSASIEAPSGHKESCVLKKLPNGHIGISFTPKEIGEHLVSVKKRGRHIANSPFR
IMVGESEIGDASKVKVYGDGKESACAGETAVFMVDTRQAGYGGLGLSIEGPSKVDINCED
MDDGVCRVTYTPQEPGNYVINVKFADKHVPGSPFTVVCTGDPQKKGSILRQQKAASVATV
GSTCDLNLKIPNNWMDLMSSGAKSTRHASSFSQSYSRVEQSSFRSTGVSSQSQSMVRESF
SPSSQSSHSLLTSSASPFVPKFTSSQGKFGTFEHSLKATEPHEMGVHTVSVRYMGQHVPG
SPFEFTVGPLGEGGAHKVTAGGPGLEGAVVSVPADFSIWTREAGAGGLSIAVEGPSKADI
NFEDRKDGSCGVSYYAITYTAKEAGDYLLIVKWGDDHIPGSPFHVKI
Download sequence
Identical sequences 7719.ENSCINP00000006732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]