SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7719.ENSCINP00000016651 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7719.ENSCINP00000016651
Domain Number 1 Region: 87-182
Classification Level Classification E-value
Superfamily PDZ domain-like 9.6e-29
Family PDZ domain 0.0093
Further Details:      
 
Domain Number 2 Region: 8-63
Classification Level Classification E-value
Superfamily L27 domain 1.35e-19
Family L27 domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7719.ENSCINP00000016651
Sequence length 199
Comment (Ciona intestinalis)
Sequence
MALTAEPLTLERDINRACELIDILKSSGQVPTQKLEQLQAVLRSDFLQAVREVYEHVYET
VEISGSPEIAANATAKATVAAFAASEGHSHPRVIEMPKTEEGLGFNVMGGKEQSSPIYIS
RIIPGGVADRHGALKRGDQLLSVNGVSVEGECHEKAVDLLKAAQGSVKLVVRYTPRVLEE
MENRFERMRLSRRQNQNST
Download sequence
Identical sequences 7719.ENSCINP00000016651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]