SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7719.ENSCINP00000017488 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7719.ENSCINP00000017488
Domain Number 1 Region: 3-131
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.14e-45
Family Calponin-homology domain, CH-domain 0.00000207
Further Details:      
 
Domain Number 2 Region: 230-298
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.1e-16
Family EB1 dimerisation domain-like 0.00051
Further Details:      
 
Weak hits

Sequence:  7719.ENSCINP00000017488
Domain Number - Region: 141-211
Classification Level Classification E-value
Superfamily Membrane penetration protein mu1 0.0124
Family Membrane penetration protein mu1 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7719.ENSCINP00000017488
Sequence length 312
Comment (Ciona intestinalis)
Sequence
MAAVNVFSTSMTTGNLSRQELVAWVNDSLELNISKIEHLCTGAVYCQFMNMLFGNKMHMK
KVKWGSKLEHEYIANFKLLQDCFLKTGVDKVVPIEKLVKGRFQDNFEFVQWFKKFFDANY
QGQDYDAKYMRGGAGLAVSGGAKSQFKPRVETKRTAAPNISVKPVKHDSTGSSGAKPSVS
DIETNGHNSESDITENPRSSASSRTTVAPQRIPSASSAATNQELSALRLELEEQKEQNRE
FQSSVEALEKERDFYFGKLRDIEMICQEVEQQEEMGEDVKLPFNKITTVLYATEEGFEAP
EDDLDGNPEDEY
Download sequence
Identical sequences A0A1W2WGQ8
XP_002127374.2.78797 7719.ENSCINP00000017488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]