SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7719.ENSCINP00000017773 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7719.ENSCINP00000017773
Domain Number 1 Region: 196-397
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-52
Family DBL homology domain (DH-domain) 0.0000096
Further Details:      
 
Domain Number 2 Region: 667-770
Classification Level Classification E-value
Superfamily SH2 domain 5.92e-25
Family SH2 domain 0.00056
Further Details:      
 
Domain Number 3 Region: 2-121
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.84e-24
Family Calponin-homology domain, CH-domain 0.0017
Further Details:      
 
Domain Number 4 Region: 401-545
Classification Level Classification E-value
Superfamily PH domain-like 2.94e-20
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 5 Region: 783-846
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-16
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 6 Region: 574-659
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000158
Family SH3-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7719.ENSCINP00000017773
Sequence length 847
Comment (Ciona intestinalis)
Sequence
KELWRQCVRWLTDTGVLPRDHKTCQPHAVVFDLAQTLRDGVILCNLLNVIQPGSVDFTQI
NLRPQMLQFSCLQNIRTTLHALNNVFRLQETFLPSDLYDMTNIPLVKYEIKSVVIMLLPY
YMWLRPFPESHVGRKQMYNHEEEEDIYSNLADMASQRDLADEEENLYDSVPEDVDEGIYG
SLIAVKQATGTLKVSWDDKRGYCITEIIETERNYVQHLTMMVGKFIEPFRQHQGIDEKDI
RAIFMNIEDLLPIHQDFLRELEKSSSESPSTLSRPFLKFKDRFLLYGLYCSKLIDAQDHL
EDVKKMNPRSGMFVEECEARASPSKFKLRELLCVPMQRILKYQLLVKELNKHTIDKHPDK
GELAGALESMQELSHYVNEVKRDSEMLITINQVQSCLQIPLNSYGRLQKDGELRIKSTMD
KKAKSRNTFLFDQALFMTKEENGNYHLKDLLRLEEYKLEEIQQSKGGKWTWNWCLSATKN
GCNSYMLYAKTAMDKTKWIEKLKDSFDNISPRELKNKSHNFKMHSFSEPTYCNNCNKLLL
GTFYQGYWGIPTKFCVFIEMLKCDLKLPSKFQNTKQLLEKSAVPPPTMYRAHRDYNGNPR
PPFPGVMTISFSSHEYVMVDEEVNSDWWLVNLDRKGYFPASFVSPVSVPGEFPRRSNHPP
VTPPQQAIPLEENIWYAGTMDRGEAENLLHDKPSGTFLVRTRDGHLAISLIYSKEMKHIR
INRSSEGLYFVAECKNFKSVQELIRYYRENSMSSSFLGLETSLQIPYRDPNFFPGMPGPN
TRNFPPQPQVPPVVLFNFSPRSPQELGLREGQPVNVISTAGDAHGWWKGESEGQVGYFPA
TFVEEIR
Download sequence
Identical sequences 7719.ENSCINP00000017773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]