SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7719.ENSCINP00000020699 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  7719.ENSCINP00000020699
Domain Number - Region: 20-62
Classification Level Classification E-value
Superfamily HMG-box 0.0691
Family HMG-box 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7719.ENSCINP00000020699
Sequence length 112
Comment (Ciona intestinalis)
Sequence
SPPKQQQKGGKTSQKASKPSGSGKAKKKKWSKGKVRDKLNNLILFDKATYDKLYKEVPNY
KLITPAVVSERLKIRGSLARRGLIELLNKGLIKQVIQHSSQVIYTRTTAEEA
Download sequence
Identical sequences 7719.ENSCINP00000020699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]