SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7719.ENSCINP00000023885 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7719.ENSCINP00000023885
Domain Number 1 Region: 23-69,105-204
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.78e-21
Family Calponin-homology domain, CH-domain 0.0094
Further Details:      
 
Domain Number 2 Region: 213-280
Classification Level Classification E-value
Superfamily GAS2 domain-like 2.62e-20
Family GAS2 domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7719.ENSCINP00000023885
Sequence length 321
Comment (Ciona intestinalis)
Sequence
MNGNIVTSCDTSPLAAKIAEEHEKCLVPLKDDLANWLSKLFDKQFNAENLFETLQTGSLL
CQLAAFIHKFAAERNVRPKSAKHRSGEGPISAQLALRGHSLPIPEPPLFRASAQPGSFLA
RDNASNFIDWCKRLGVDDSCLFKSEGLVLQKQPRNVVLCLLDVARKAARHGIPPPELIKL
EDEIDRQEVMRDEQEVMSSISINLNKRAKVLKLDDAVHAVVDGQPFNGQVNIKRIGEGRY
KIDGKIVFIRMLHGKHVMVRVGGGWDTLEHYIISHDQSRHFGGDVNSNPRPKSAKPRRGV
SPGLKINSGLLNPVPSKFGRK
Download sequence
Identical sequences 7719.ENSCINP00000023885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]