SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7719.ENSCINP00000026560 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7719.ENSCINP00000026560
Domain Number 1 Region: 302-329
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000373
Family Ran binding protein zinc finger-like 0.0022
Further Details:      
 
Weak hits

Sequence:  7719.ENSCINP00000026560
Domain Number - Region: 181-238
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00301
Family Mitotic arrest deficient-like 1, Mad1 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7719.ENSCINP00000026560
Sequence length 339
Comment (Ciona intestinalis)
Sequence
MTKMNLKRTSYPTITVPKTLENSQAYHVDYPRNTGDSSPQVIRQQSSPSIISPTGVPFLP
HSTSQPVMNINQFTPIGNTGFNSPERNSPVMYHMSPNLRRKSAPATDTRPFLKTNTRRTV
SQIPQHIAPPNGLPGSSYLKDSFLPTLSDPLEKVDEVPTVDTGYNDDDYTNALLQHQTER
MNRLRAEYNAKKCELENLGGDVSHLEEKVQQRNLRHKSPSSLQVEIGRLREINRQLEIDC
NCMYKEVDLFSKDGDNTREDFYSRYNRPASVKPQQTKQRKASLRQFTSVQDLPPPPPPPP
DDEPKWRCSHCTFDNHAALNKCEMCEFPREVQSSRARIT
Download sequence
Identical sequences F6VM15
7719.ENSCINP00000026560 ENSCINP00000026560 ENSCINP00000026560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]