SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7719.ENSCINP00000026796 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7719.ENSCINP00000026796
Domain Number 1 Region: 16-175
Classification Level Classification E-value
Superfamily Sema domain 9.03e-32
Family Sema domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7719.ENSCINP00000026796
Sequence length 182
Comment (Ciona intestinalis)
Sequence
MINASQTSTSGEISYLERLQWTSNPNSSSTCIDVGKQEYECKNFIRVVELRQDNTLYVCG
TNSYEPKCRIYTRAQFAAATPHNSPYTSEEMCNEQCGCPQNPVTTSVALYTNTSRGFKMF
SAAVTDFMGKRSYLVRSGNPSLKSVHKWLNDPSFVKLIEYGEKVYLFFREIPTSVETGAD
HL
Download sequence
Identical sequences 7719.ENSCINP00000026796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]