SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI104570 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI104570
Domain Number 1 Region: 38-81
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000645
Family Fibronectin type I module 0.0038
Further Details:      
 
Domain Number 2 Region: 85-124
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000284
Family Fibronectin type I module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI104570
Sequence length 125
Comment (Branchiostoma floridae)
Sequence
MTYQPGCTPVQVGCCYEMQCGTGTGTGTGTATQMPVAVDVCQANGQTYQIGQQWYMTNGG
YMLICTCEGNGTGYYSCAPSNNPANERCVYEGQSYTVGQTWQIQYQGFTLTCTCVGEGTG
RVTCG
Download sequence
Identical sequences 7739.JGI104570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]