SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI105640 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI105640
Domain Number 1 Region: 44-151
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-35
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI105640
Sequence length 156
Comment (Branchiostoma floridae)
Sequence
MASFIFLLWCLLASFEGGPQPPTLPPLRPVTAWVESGCGGPRDLSGPSGSFSSLQHPTTY
PHSHHCEWLITVDPGMVVTLTFDAFDVEHHDTCSRDSVLVYDGPNTSSGLIGEYCGNVPP
RRIVSSGEQLYIIFNTDNANASTGFSASFLSADPST
Download sequence
Identical sequences 7739.JGI105640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]