SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI106026 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI106026
Domain Number 1 Region: 1265-1568,1596-1650,1686-1733
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.89e-53
Family Calponin-homology domain, CH-domain 0.0011
Further Details:      
 
Domain Number 2 Region: 2721-2795
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000531
Family Motor proteins 0.028
Further Details:      
 
Domain Number 3 Region: 2502-2576
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000133
Family Motor proteins 0.028
Further Details:      
 
Domain Number 4 Region: 2431-2503
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000929
Family Motor proteins 0.024
Further Details:      
 
Domain Number 5 Region: 2654-2722
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000149
Family Motor proteins 0.021
Further Details:      
 
Domain Number 6 Region: 1737-1838
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000451
Family Motor proteins 0.024
Further Details:      
 
Domain Number 7 Region: 2875-2940
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000112
Family Motor proteins 0.021
Further Details:      
 
Domain Number 8 Region: 2180-2256
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000141
Family Motor proteins 0.046
Further Details:      
 
Domain Number 9 Region: 3146-3271
Classification Level Classification E-value
Superfamily ARM repeat 0.000000288
Family Armadillo repeat 0.024
Further Details:      
 
Domain Number 10 Region: 1912-1974
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000319
Family Motor proteins 0.023
Further Details:      
 
Domain Number 11 Region: 2040-2110
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000664
Family Motor proteins 0.024
Further Details:      
 
Domain Number 12 Region: 2575-2653
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000797
Family Motor proteins 0.018
Further Details:      
 
Domain Number 13 Region: 2107-2181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000112
Family Motor proteins 0.046
Further Details:      
 
Domain Number 14 Region: 2794-2872
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000151
Family Motor proteins 0.018
Further Details:      
 
Domain Number 15 Region: 2254-2326
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000478
Family Motor proteins 0.046
Further Details:      
 
Domain Number 16 Region: 1832-1912
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000258
Family Motor proteins 0.022
Further Details:      
 
Domain Number 17 Region: 3058-3116
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000478
Family Motor proteins 0.037
Further Details:      
 
Weak hits

Sequence:  7739.JGI106026
Domain Number - Region: 2377-2427
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000345
Family Motor proteins 0.021
Further Details:      
 
Domain Number - Region: 3002-3065
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00478
Family Motor proteins 0.015
Further Details:      
 
Domain Number - Region: 1974-2039
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0266
Family Motor proteins 0.019
Further Details:      
 
Domain Number - Region: 1192-1240
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0462
Family Calponin-homology domain, CH-domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI106026
Sequence length 3348
Comment (Branchiostoma floridae)
Sequence
MMSLPQWKQVLVEQRQRKAAEERRRQAEQEARLNRMPAWKRDILVRKKSRSDPKSSPVDS
ADHNVIPYEDSGPPSRTGVLEQNGESSLGEGGPSDTCRTTHGWKEQGVSEEKVVSVHDNI
FVKWQARNRSPSNDRNDTLVAHSGQHKPHSPRGVGIPNNVIIIEKYGGSGYDRQADVGKE
SVQGVGPAGMERPPAQTVFSLLRDAKPEREVIIIEKDDTEDKSVPCTLSGKVNRLRGKFG
DEPRDRADVLSATRTKVPETMKSNTRQRKGQKSSLSAAGSMDSLLDVVQQPTHTQNKKFH
YSSCENLTELDTLPPYVIPKSGSDDSVTVDTTPNIRPRSLSQSKMIDTVEPRVRKTGKVK
VESTEPISQQKTREAPKDQVTNYRLHGDRSSKPSLRVRPVSVTRSVPGGENHVHLAGQSH
AAKVNKQEKKISLGNELGSTRRDAGTLPHSKNLPEEGIQIIPAKANSSAKDTENQNDPVA
AAIASIKAQSKNTFIVQPRRPASKHTETKNKDTEHRKIKEPSHHKDNGPKEDVKTPALPL
PLQSNKKQDSSRKNNNVEQKNDTSFVIRPLTQVLKENPSGYQSEKVRKSSEKQPNSKEQK
GNITFSSSPTAKAVVEPRDRPQSNLHANSTFLQQDSQDAPSENRKAQPGRKKAPAPQPPS
VAGVNAQGTERSQAVQVKPGTQEREELPTTNIDDVEISTKSQNNNSVQSAKTGDQAATRM
MQSSPAGSEVSKTAASPPSLDVSPIAPPRHKGTVRKLTVADYVVIGGYEKLGKSSISKGE
SKKLKISFNDSPTTFEYPSEQSLLEEDDGKGVQAPAGLRTTPSLTTAAGDKVSGGLHSYQ
PSQVTSDVVAGQQRSVASKAPEASQPAAEARPVEIFAVKPLADSEAPMWSSSSSMASYSV
DLTEVEVQAAEDIVVTLQWTPGEECNSRALLGLKLDNAFRLHVILYGRAVVPVRAKRRVR
PREAVRQGSSVARPGPDAAPDTDGENIPPDQPDIGNGPQVKHSHSTDTSVEQGNKHPDVS
MINSHGSTDVTKPSSVQKSKPASVQKTKRILQQSTVTKRRQNFGKSSEDVRIKAAKKELF
CPPNSDSDQPQQQLTNIHSSGSSTKSGVRVQSQTQETPLDPGKPLVLRSAVSKNKVMAAN
KHPQKELVKRGDTLSKKSQAVKVKSTQVKNQVGTSGTTRSKPKVAKSKLCLVNTSKRQES
AHHYMPYVSKNMYYDERWMQKQERAFIQWLNFILIPNTMVSQPRRNGTAVQMCEYAVLCN
LNQLRRAACLLFQSEPMARVIHRLEEEVETGRLQVRADRHLHADQGIRQAILDMLLSYSP
LWLRIGLETIFGEVLPLQHNDDVAGLSRFLLNRVLGNSDIAQQFSHPTVPHMYKTGYAAA
LAKFTLKKFLTLVFFMDRAKLTRLIDQDPCLFCIHANIKSSKELLLTFSREYLSGEGDVT
RHLSFLGYSVTHQQTALMEMDYTVQNLATDLRDGLRLSRAVELLTKNWTLSSKLRAPAVS
RLQKIHNTKVSLEALQEAGVSLDTGLRGGKIEARDIVEGRQEKTLALLWKLIFHFQVCME
VEQLQLQKEVTLLRRELHLRRGRDVWLEMYGPDCGETTDHERLLLQLCQAVCAFYNIRVD
NFSMSFSDGRVLCLLVHHYLPELLPVEEICMDTTQSYITNYTGQAGTTQAECPETDKDRL
KELLAYEKNNFKLVNQKVLELGTIPPLLCATDMSNTIPDQKVVMATVSYLCARVINLSQK
VRAVRIIQAAWRRYHPKPAVGEWTEDVQTATIRLQAAVRGMIVRRSLQTQHKSATTIQAA
VRGWTARQQYMKQRQAAIILQQQVRAHLKRKTAQQKYQHVRRATICLQAAVCGMYVRRRQ
KQAQLAATKIQACWRGHQQLIKYKAIKLATAIIQQRFRAFKLMQEEQHMYRSLRSATIRL
QAAVRGMLVRKSLQRQHKSATTIQAAVRGWTARQQYIKQRQAAIILQQQVRAHLHAAVCG
MYVRRRQKQAQLAATKIQACWRGHQLLIKYKAIKLATAIIQQRFRAFKLMQEEQHMYRSL
RRATIRLQAVVRGMVVRRLLQRQHKSATTIQAAVRGWTARQQYMKQRQAAIILQQQVRAH
LKRKTAQQKYQHVRRATMRLQAAVRGMIVRRSLQRQHKSATTIQTAVRRWTARQQYIKKR
QAAIILQQQVRAHLKRKTAQQKYQHVRRATICLQAAVRGMIVRRSLQRQHKSATTIQTAV
RRWTARQQYIKKRQAAIILQQQVRAHLKRKTAQQKYQNVRRATMRLQAAVRGMIVRRSLQ
RQHKSATTIQTAVRRWTARQQYIKKRQAAIILQQQVRAHLKRVSYRGDVTSVSEQRCAVC
RLLLEDGRLEGHISRSGYTTGLLWSSRARTGVLQHAKFCRSLQRQHKSATIIQAAVRGWT
ARQQYMKQRQAAIILQQQVRAHLKRKAAQMNYQHTRRATICLQAVVRGMVVRRLLLRQHK
SATTIQAAVRGWTARQQYMKQRQAAITLQQQVRAHLARKTAQQKYQHVRRATIHLQAAVR
GMLVRKSLLRQHKSATTIQAAVRGWTARQQYVKQRQAAVVLQLYVRAHLKRKTVQQNYQN
IRRATICLQAAVRGMYVRRRQKQAQLAATKIQACWRGHQLLIKYKAIKLAATIIQQRFRA
FKLMQEEQHMYRSLRSATIRLQAAVRGMLVRKSLQRQHKSATVIQTAVRGWTARQQYMKQ
RQAAVVLQLYIRAHLKRKTAQQKYQHVRRATICLQAAVRGMLVRKSLQRQHKSATTIQTA
VRGWTARQQYVKQRQAAVVLQLYVRAHLKRKTVQQNYQNIRRATICLQAAVRGMYVRRRQ
KQAQLAATKIQACWRGHQLLIKYKAIKLAATIIQQRFRAFKLMQEKQQIFRSCKSAAIRL
QAAVRGMIVRKSLQRQHKSATVIQTAVRGWTARQQYMKQRQAAIILQQQVRAHLARVSYR
GDITSVPEQRCAVCRLLLEDGRLEGHISRSGYTTGLLLSSRARTGHWRAEQQRRLLHFSA
AAYHHLAAVRLQRCYRRYLVWQKAKQQLKALITIQASVRAWLQRKHYLQLRQAVCKLQAA
VRYHQKQHLDAAVVLQSHFRMYLAKKLMIQRKKAVITMQAIWRGRHVRKNIKNKRIRIAR
AKILAAQRAATEDKKLCNMTATALNLLLKYKHLSTILDALRSMEVVTRLSAVCCERLVQG
GAVQVIYTLIQSCNRSLPCQEIIKYSISILLNLAKNPATVAAAVVQEGGVETLVSLMAIY
REKDDVIFGQTCLLLTLFCNNAAYQKEVLNMPSVTQKLQSLYRLVKRKAGMSRNKQRMGS
QEDKRRTSTALVQMVHHIKPAWILRKDNMLDVPDPLQAVQLVLVTLDL
Download sequence
Identical sequences 7739.JGI106026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]