SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI112897 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI112897
Domain Number 1 Region: 5-105
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000000183
Family DBL homology domain (DH-domain) 0.007
Further Details:      
 
Weak hits

Sequence:  7739.JGI112897
Domain Number - Region: 101-142
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00327
Family DBL homology domain (DH-domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI112897
Sequence length 169
Comment (Branchiostoma floridae)
Sequence
MCCLINLQNEALLCEIDTEKLFSNIQEVEQCNSAFWQDHMCHVVTKARQRREPLKPSDME
EGFLEFEEMFQPYVKYCMEEEACVAYMKDKFRDNDLFKQYVELFMCCLINLQNEALLCEI
DTEKLFSNIQEVEQCNSAFWQDHMCHVVTKARQRREPLKPSDMEEGFLE
Download sequence
Identical sequences 7739.JGI112897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]