SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI116967 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI116967
Domain Number 1 Region: 118-181
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000915
Family Tachycitin 0.044
Further Details:      
 
Domain Number 2 Region: 24-85
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000139
Family Tachycitin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI116967
Sequence length 184
Comment (Branchiostoma floridae)
Sequence
MAAVMTLMVLTCLTLQFKTAAAGEDPYFCLDKREGEYADPSSCHHFYKCFRGRARRVACM
LPEQVYNEQIDECVYRFEAPPPCGLNMFNRTSNMAAMVILVVVTGLILQFSTADEVTTDT
EFCLGKPNRDFLDPLNCHYYYKCSNEEAYHVPCQRPMIINLVYDEEKGQCVYQRDAPPPC
GTKQ
Download sequence
Identical sequences C3YKM3
7739.JGI116967 XP_002603080.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]