SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI129608 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI129608
Domain Number 1 Region: 1801-1924
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000515
Family Calponin-homology domain, CH-domain 0.0057
Further Details:      
 
Weak hits

Sequence:  7739.JGI129608
Domain Number - Region: 132-176
Classification Level Classification E-value
Superfamily PapD-like 0.00194
Family MSP-like 0.022
Further Details:      
 
Domain Number - Region: 380-476
Classification Level Classification E-value
Superfamily PapD-like 0.0288
Family MSP-like 0.037
Further Details:      
 
Domain Number - Region: 2671-2728
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0314
Family Transglutaminase, two C-terminal domains 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI129608
Sequence length 3307
Comment (Branchiostoma floridae)
Sequence
MEGDVAGVRINPPVVEFIDIVPNEQYKCTLTVQNISRASKIIKFHAPSTSEFKLKVRNPD
RPVASGLEVVATVDFQTDKNDDCKDRIILLVDEDVVEIPLYAFTPSPIMVLHGPVDYGMV
VADSRILRRETVVENHGSMPGEFKIKYSGSLPITIAPVSGTVEPRSYQIIRIEFATKDPG
TFEEEVEVRLEGQDPRTLVIKGCVVEQKLHLHNKDNEPLDCVKFGSTFYGTDCIETGYLY
NEGPKEISFVAILDEGGVGEEAGVDLTKSTAATLAIADKERARGSCNPLTSLVTAIPNQG
VVGPYQRVPIHFRFAPRFSSAEIGWKGLTKSPPRQDYALYMRFEMIGSREGMVTRDFLNG
SARNGVTGVEVAITATALPILVNLSPHNALDFHECPVGEHVDALCTLRNESTMLPLTYKF
RKIAHFSSTPYKGKIGPGEGQDIVFSFGPKQVGNLRSNMVMDIVGFRANEDDPARLIKQA
IHSFPVELNGIGQPLVKKRDPRFNPGITPLVVGETGQFVDVTFSDTKPYTPRAAVLNSTK
TSIHTPKTLTGSREDRNALVAYPNDRAGSIRPSDRREKYRTIFTKAERHTFVDPDYAYTE
EEEQKKHEHKQKYIGFLREQRTNREKMKMEREFVELNNKVDMGMKPASGLRPPKVKDKDT
ITAGEPGPLPNEKTRLLSTRELREAERTATVRPVSEGLNAVPTTPQEKSDCKKKLTPQEL
HQVVIGPPTIEFGEVCLRSTSVKELNIMNNLNQHIRVVVDIDCTELRQTSPLSQVVPPCA
KAQLPLIFESHHKGRFQRSVMYTVNGHHTHHVLVMAEVVPVALELSTQELIVKPFSGMPA
DAGLRGTVTLHNKRNYPAEFQWHPILGERGMAFSIRPASGTVDAFKDLACEVVFHPSYLA
PEEGEFNLLVNGGGTEHLKCSAKLGQTAVQFVERRILFGSVPINMTTTRTALLHNTSQHH
AYYQVVDPNPFPGLTVSPIHGAVPVGGYAELKIELTPNAVIKFDTRIQVAIRGWKTVELR
MGGKVDPPCVDIDMKEFKLGGVFCGSQFTIPFVLGNLTRTKTKAEFDLTRYMDFRINFLK
QDLEIDPIDPLTPGMYRIMLEGEEIVPCELVFSPTEVASYDFLMPVHINAMDAPSPTPSS
FPPTPAPSVQHIIPPRIIEVSIATPRRRILATALRQPLQVSNLNLEFYLPPGFMELGIAS
DVGQRGSNSAASQVQNLDQYTVLVNNSPSPITWGLDLEACKSEALEEGTFKFLGPGGVPF
VNYREKGIEGTLQPGETYELGVLFCPNCPGQFYAKVPIILNGKRELPYQYLQVRGNMRSP
KVTFDPLQVVLMPVPLATEVSAEFSIVASAYTKPSSIKVEIPDIELDDGSIASVLKVDFP
KGQNIQPCSQDAGQEEPFIFPCVVTFASPRPVSFSQPITFVDDEGRSFTFHVSATADNCV
LSNYPFLAKHRTDHHIIRNEEETREIVVREGTGALGEAVIIPTASPRRPSTHGSTTGTST
AFGMSSSSYEDTSNSVTGDTYPSSPREGAVPQLPAADSEIQQERQEAASRSLGSAAFPEE
DSEEGIFHGEVALSAQRWFSMHGWPGGPFPITIPQSLRKGVSRMHTDPDERSKVTSRGGS
WDASSLKKEIKTVYDMITHLSGRPVPGIPINQPLPVDPTERVLQLHWQHATLLTFIKSQG
GCVAAIRPEYLMEPEDFRWWVKVQARNRVKEERRSREMAAAAGIEPELTFEEEAERRELE
EVLFESVSKKAWSDVLLQLLKVLVLSRITPRQFKNIPLPIKDIPLPTVNPDPLASNIYGV
GERILLAWLNHYYEHMRHKVWADCDKGGVPPSRWVVNFDFDLLDGLVLGAVLAAHVPFLI
KTHLNSMYTHPSTPEQCLHNALKITSAFKTIGLDYDIQAIDITDPNPVAMLLLCVHLYQR
LPHYLPKATVEFVGSLHATVQKEVRLTNPSSKPLIYHPMIAGRDARDFIIPKAEAISVPP
RGTHNLPVEFTSRLLRPAEAVLVLVGRRAGASVGSTLVFNLRTLVDNITPKSFSNKQGNI
KIESPCYELYRCKLNVTNPFDEPGEFRIVLVEAREPFPSPKARKSASQKSSSAKSMKKVK
SKIDHGQKKVDSPSPPPNDEKIEITAAVEKSTTDNTVFGSFFSPKASVHLDGRGSAEVEI
EFLPFQTGHRQCSVLFINEEVGEFLYSIEASAVLPLPSVLPWVPSPHSVRISSAAAAGKG
RGLFGGDDRVIYWKCENNSVLKENLVIPITNAARERSLVIAAQQRMSEYERERRKVAGTL
ASGTVTAAIAAMGLHDRVVDRSRHITTSHMLIAPPEGTTFNVQVSSPLFDAPIQVFVPSP
LNNRPKPASEVAREGPRMERSAAGIVGNQGVILDDGTINIPIKFQPKGAGHYPCRIVLFA
PNDVRVFQLEVIVNPDGSTAELEFVTPAHQSVSQDIPIHNPTLHDWELKAELEGDGFYGP
PLMLARAQQTTLYPLMFRPVLECLSLGRLLLRNHEDGTEHIFNLKGLGQKPLALDHIIVP
CRARERVTKVVQVPNVSNRKLIYQVSSSLSCVSGPPTVTVLPGQTTPYRVSITPWQRGTF
SGVITFVAGDAQKLREEDSSSDEDDELPTSPVTPSSRMSSFAGDTDGDFPGGYRVWYSLE
IQASPPEPEKRLQITCSAQLLDFVREGGVPKSAAMMEVPIQNPTNKELTLSVTIEGAGLS
GEPKVTLTPGEEKWYQLLFAPTVVGKTRGSLIFYGETVGEFWYDLDLVANTPAPKVLPQM
ECELGRWTRQFIRLYNPTDEPIELEPQNSNPNNFSLEVDPAKPIILQPRSSLMVPLQFLP
SALGSANHTAEITFCSEHLGDWVYLASGTGILPQPLDPVMVSAEFQSNTSLIIPFRNPFD
EPVIVDVILTDQKQFLHKISESVIKQSITTESAFCLLLKHPHNIHLAPRATLDLPLTFAP
NRMELHEAVCVVSVRREDGQSWKFGAQAMKIETLDGESGERSASRTSSGGLRDVRWIYPI
HGVPESHPVKDAARAATVECQARNRVEERLEVTLMGAAPSSAGGYPNPMKTRAITPIDAQ
RPSTDGVIVGEGNTVAEEFSYEIEYDSEDAQSLLEHSLGLSLVRKQRDRVSGVVVLVFNL
IFAPAKPLRHNVELLVRSATGGVWRFPIRLCATEPTPDDIITIESVGLNKESAVAFRLTS
QQSHPVAFHAYFVAGSDPEFHVTPQTGELLPLGTNGTQIGISFTPRIYGKQYNAKLVIQT
HDMQWTYNIRGMPQVYKPPVGRSSSPIAGPHPKPTLYGPKRNFLKENMQLVTTGVSSPIK
GTSILLK
Download sequence
Identical sequences 7739.JGI129608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]