SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI131960 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI131960
Domain Number 1 Region: 513-910
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.36e-50
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 9-119,215-297
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000835
Family Calponin-homology domain, CH-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI131960
Sequence length 1063
Comment (Branchiostoma floridae)
Sequence
MSLRTRINGFTAWVNLRLVSYSLSISNVLSELLTGSHLKMLVQSFTGMQMKKLQSMDGLT
ETQKLTRVEWAVTALKKSQVIEEEARVDCRLVTMRSADHVFDLLWHLIAYDIWFTWERAD
YLLQEDLEVLTQVPYKWTPEPPPPKKKPKRKVKTDLLAGFGAKASVADGPEEMDRYPGTD
VALSYKKNLPRGGWMSYPDPDDCILDMVCTQLARVREGSKLTVESLDDIADSRVLCALIN
SFVPGTFTTEVLLNDRWTLNLALQTIGAMTYCSVPMTSQDLVEADPKALSAFMCFFFMSC
FKFRQSRAVKARVYELHLLMQEVGAELDTLPDVAGNMAELRYKKELKSQHDSYREELEEL
QQNYDIKYCEEWVEHVADVQLQTHKQVASKMKERFEVLTVPRSITINEMCITLLINLSLS
QGAGFYRMDNKEIVTADRKLVFPCSTLQWQRMMMRAGKEGDDEMMNKLVSFFRVSHPSFI
NSQEANTGNSVLHVASRAGHFNNQAPYILYFYFKNIVQYLLKNGANVNLRNASGGTPLFS
AAEGLHRRVAQLLLEWGADVNAKNFRCMTALEGLRSDDLKDNLTAVTAYLSSIRPKIMEG
DMQTLKRVIHDHVTGAHQFADLSSRCISGSTLLHTAAYFGATSIVKELLKERVDVNLSDY
KGATPLHRARDTATIQLLLDSGAAINARDNEGNTPLHILSYGEKGQPSQLECLQALLDSG
AHITLCNNKGLLAAHCCAMQGRTDAIKLLVDRDGDEAMRAIIDGEEGTKLPSLAYLAVVN
GFLACASWLVRENFLLKPGEADQLLQIVLLKSADMEDAALFVQFLLDNQADVGARFAQGN
TPLHLAATSVTAVESLQLLLSYGAEVDATNDLQETPLFTAVRANNHYAASLLINHGVNVR
CVNLVGLTAFDQIRDFDEWLECSFFSDEIKARMKAFSLKHARDLVRAITKKVKTAAPLSS
ARLPVLNTSVHWERSRVEAATPSSSHRIQTAPPQSRPPGTGRSISTQVFPERVAFEFQMM
QTLTSSKFISLYDGKVEEDITRTCYNLTNYTSTKIINTNPMVS
Download sequence
Identical sequences 7739.JGI131960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]