SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI132043 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI132043
Domain Number 1 Region: 17-163
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.08e-42
Family Calponin-homology domain, CH-domain 0.00042
Further Details:      
 
Domain Number 2 Region: 1749-1867
Classification Level Classification E-value
Superfamily E set domains 1.53e-36
Family Filamin repeat (rod domain) 0.0000372
Further Details:      
 
Domain Number 3 Region: 1559-1674
Classification Level Classification E-value
Superfamily E set domains 2.99e-35
Family Filamin repeat (rod domain) 0.000029
Further Details:      
 
Domain Number 4 Region: 1272-1385
Classification Level Classification E-value
Superfamily E set domains 6.09e-34
Family Filamin repeat (rod domain) 0.0000273
Further Details:      
 
Domain Number 5 Region: 1365-1484
Classification Level Classification E-value
Superfamily E set domains 9.55e-31
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 6 Region: 3099-3193
Classification Level Classification E-value
Superfamily E set domains 1.67e-28
Family Filamin repeat (rod domain) 0.0000355
Further Details:      
 
Domain Number 7 Region: 2918-3012
Classification Level Classification E-value
Superfamily E set domains 1e-27
Family Filamin repeat (rod domain) 0.0000219
Further Details:      
 
Domain Number 8 Region: 3294-3387
Classification Level Classification E-value
Superfamily E set domains 1.4e-27
Family Filamin repeat (rod domain) 0.0000248
Further Details:      
 
Domain Number 9 Region: 1663-1770
Classification Level Classification E-value
Superfamily E set domains 1.73e-27
Family Filamin repeat (rod domain) 0.00017
Further Details:      
 
Domain Number 10 Region: 1472-1579
Classification Level Classification E-value
Superfamily E set domains 3.02e-27
Family Filamin repeat (rod domain) 0.0000687
Further Details:      
 
Domain Number 11 Region: 466-561
Classification Level Classification E-value
Superfamily E set domains 1.27e-26
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 12 Region: 660-767
Classification Level Classification E-value
Superfamily E set domains 4e-26
Family Filamin repeat (rod domain) 0.00049
Further Details:      
 
Domain Number 13 Region: 557-655
Classification Level Classification E-value
Superfamily E set domains 4.14e-25
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 14 Region: 3620-3711
Classification Level Classification E-value
Superfamily E set domains 1.07e-24
Family Filamin repeat (rod domain) 0.0000169
Further Details:      
 
Domain Number 15 Region: 3487-3578
Classification Level Classification E-value
Superfamily E set domains 4.87e-24
Family Filamin repeat (rod domain) 0.0000363
Further Details:      
 
Domain Number 16 Region: 270-383
Classification Level Classification E-value
Superfamily E set domains 6.21e-24
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 17 Region: 172-268
Classification Level Classification E-value
Superfamily E set domains 1.07e-23
Family Filamin repeat (rod domain) 0.00091
Further Details:      
 
Domain Number 18 Region: 3386-3481
Classification Level Classification E-value
Superfamily E set domains 2.74e-23
Family Filamin repeat (rod domain) 0.0000983
Further Details:      
 
Domain Number 19 Region: 1889-1975
Classification Level Classification E-value
Superfamily E set domains 2.4e-22
Family Filamin repeat (rod domain) 0.00023
Further Details:      
 
Domain Number 20 Region: 3000-3097
Classification Level Classification E-value
Superfamily E set domains 5.07e-22
Family Filamin repeat (rod domain) 0.0000329
Further Details:      
 
Domain Number 21 Region: 748-798,842-894
Classification Level Classification E-value
Superfamily E set domains 5.61e-22
Family Filamin repeat (rod domain) 0.002
Further Details:      
 
Domain Number 22 Region: 906-937,1142-1207
Classification Level Classification E-value
Superfamily E set domains 5.35e-21
Family Filamin repeat (rod domain) 0.0014
Further Details:      
 
Domain Number 23 Region: 3213-3307
Classification Level Classification E-value
Superfamily E set domains 6.41e-21
Family Filamin repeat (rod domain) 0.000043
Further Details:      
 
Domain Number 24 Region: 2856-2933
Classification Level Classification E-value
Superfamily E set domains 5.87e-17
Family Filamin repeat (rod domain) 0.00033
Further Details:      
 
Domain Number 25 Region: 1197-1292
Classification Level Classification E-value
Superfamily E set domains 0.000000000000163
Family Filamin repeat (rod domain) 0.0052
Further Details:      
 
Weak hits

Sequence:  7739.JGI132043
Domain Number - Region: 2062-2297
Classification Level Classification E-value
Superfamily Tropomyosin 0.00386
Family Tropomyosin 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI132043
Sequence length 3712
Comment (Branchiostoma floridae)
Sequence
MHGTVKVLLPFEVICEKLNSSDIVNGKLKLILGLIWTLILHYSISMPMWEGDDEPAVKQT
PKEKLLGFVQAKVPDLPVKNFNKDWNDGKACGALVDACAPGLCPDWEDWNPNDKVKNCEE
AMDLADKWLGVPKLLSPEDMASPHVDDLSVMTYVSQFPQAKLKPGAPLRPKTNPNKVRVF
GKGVEATGNQVGSPAPFTIDTFSAGGGDIKVSVENPRGKQEQFKLEENLNKAKTYTCTYT
PTMEGTYVVKVIFAGKEVPKSPFKVGVAASKSDPSKCSAKGPGLESAGVVANKATYFDIF
TAGSVRSPLFPPLEKGPGAGPGAVNVVIADPDGKTNTVPVEMEQTGDGQFRCTYKPLKMG
IHTITVTFDGSNIPKSPFKVNVAMPKEDPASTTGTLIDFGDDSPTKGSTQKKETPLAFSS
PGLLDDGGSLDTKSPSDPLSNQQALKPDSSQDLLGFDSEEEDEDAVNAAACRAYGRGIQA
RGVRAKEVADFRVVTKAAGQGELKVSVIGPGGMEMPVKVSDQGDGNYACQYRPGKPGVYK
VNITFSGQHIPKSPFTVNVGSEAKPSRIRAYGPGLEGGQVGHPAEFVVETAGEDISGLGF
SIEGPSQAKIECHDNGDGSCDVVYWPTEAGEYAVHIVTDDEDIANSPYMAQIRPQDKKFT
PGQVKAYGPGLEKTGIVVGRTMEFTVDAKKVPAGQLQIWAYDQEAEKMDVKVRDNGNKTY
TCTYTPTKAIRYTIDISWDQVNIPNSPFRVHVAEGSYPNKVRVYGPGVEKTGLKSGKPTQ
FTVDCTEAGSAGMVNRKTLTAFELYKEHFWELVHGKANTELDKAAVAGDVSIGIKCSPGV
VGEREADIDFDIVKNDNDTFTVSYVPPAAGRYTIMVMFGEQEIPKSPFTIQVESAGDASK
VKAEGPGLEPTGVVSGKPTYFTVNTRGAGEGKLDLDFVGPSRAQRAYSPMWPFICSGPGG
SPCIATSCKPCPSNPSTSSTNPCTSPSNPPTSSANLSTSSTNPCTSPSNPPTSCANLSTS
SANPSTSSANPSTSSANPSTSSANPSTSSTNPSTSSTCTPNISNHPCTTICASCSTSISN
HSCTTFPHCTSISNHSCAPLPNSRSTCCTYGKVLPPPTPTSPGEPPSTPTSVSKPPPSGY
NKGEGGGAKDVNIVDNKDETFTVHYTPVAAGPMNVSVNYAGKPIPKSPFKVNVAPPVDLS
KVKVDGLGEKVIVNQEKEFVVHTRGAGGLGVVEITIVSVTTKKVLKTTRVEKRGDDYVCV
FTALEVGMYAVNVSYDGLVVDGSPFGFEAVPGANPGNVKAYGPGLKGGKVNREQTFTIDT
REAGQGGLGLTIEGPSESRIECKDRGDGTCSVSYWPEDVGEYSINVMFADQHIPGSPFPA
RVVPAHDASKVKAKGPGLSPGNKAGDPCEFTVDIREAGEAELTIEVITETGERVDVKIEE
THEGTFRIQYVPQIAGSYTITIKYGGDPIPQVPIRITIEQKVDVSGIRCYGPGVEGMFVD
APTEFTIDAKSVSRRGGDNVRCVVQNPSGAKTEAAVKDNRDGTYTASYTPFEEGRHLIDV
LYEELQVPGAPFKVQATEGCDPSKVRAYGPGLEGGLTDKPQQFTIETKGAGTGGLGLAIE
GPSEAKMTCKDNKDGSCTVEYFPTTPGDYDIHISYGEQPIRGSPFSVLIKDDIDVSKVKA
YGPGLEKTGVRAQNMQVFTVDHTKTGSAPLDVKVTSQMGATVNTEVTDNHDGTHTVKYIP
PSEGACKVDVKYDNQSIPQSPFNVRVEPPYDASKVKATGPGLQQGVPASFPISFTIDCRD
AGNADLEVILEDPDGRMKSPEIHDNGDGTYTITYTPEQSGNYTIEIKYGGEQVPRSPFRI
TVKPTGDANKCSVTVRISPPGRVGQGQWIGDGMQPYIQIGEETCVTVNCKTAGKGKVNCT
IQDANGEDVDVDVVENDDGTFDIFYTAQQQGEYTITIRFGGQHIQGSPYKVQAVDDLAKI
PNGTFQQQYMLSEAESQLQTTNERLSSLQKEHDDLLDQNSKLHRLYHDKLTEVEQLNSDL
VEVRGMAEINSAKLQSNISILNEEVEALKSKHKIQEGQLRDRESEIEELRRRIRELEAEN
EALRRKIADLRRELDDQTANMERYQREARDANSEVERLEQLLAQRESDIRGLQSDLLSAR
DEVNITKMKTTEITRAESEQLSSQMKLSNDLQMALNEKQGRLGAMEAEARKLRSDLEISR
RDNEEKFAEINGLKNKTRDMESELSGLNQKLYQDKQANRSLQEKLDDLQFEMNRLRRELQ
EKEGYITSMETKMSNLESSVVGQSSEKDGKIQEQMEEIRRLRMKIESLNDDMTERERKML
DLAREKEELQGQYEFYFSETSKLQTQVTEIQTVQTQMGGSTEALEDELESLRRRLKSDNE
HANQEAFELHRRITELELERNTATEKLKHMEVNMSQGSGEVEKLRQQLRRAEQDSSNTEL
RYNEMHKVNERLRSDMDDILHQRDIAQRLSKEQEAKLLSLSQRLRHLEEQTRTEILDLQS
KLRNLQNEYQLLDRKQQDTLDKLRVAESELQTERTARQSGEFSQTTVSKTTVTKTSAAEE
MDSKLRGGQPDDDHDGPDGMERVGEEKLGRKPKGHGKPRRSGSHTSSSSSSSSSSDSEDE
GKSSKKKHPKKKDGEKDKDHPKKKKGVNSDEEEPKKKGVDFGALLADAKYRPDKVERITA
VPGDEMMSVPNEAISCPDDEKSRPRWQDDAKAAPGDEPFFASPADAARQPWGKQGVVPAE
EMQSRPDELRARPWRKGVPEDVTKSGPDDTNAQPRKKWGTPGNADDDDDIRPYKRGPDKA
TPGAQEEMMMADEMEAGAPGRMRPVEFVVPIFIEVLSSGNLTAEVKQPSGRIAQPKFIDN
RDGSLTIKYTPTEAGLHELGIKYNGEHIPGSPIQFHVDEIRPGQVSAFGSGLSHGVAGQQ
SNFTIVTKDAGAGGLALAVEGPSKAEITCRDNKDGTCSVSYLPTQPGEYNIIVKFADRHI
PGSPFKAKIVGDQRKPQQVAVGAANEVSLKIAEQDLSLLQASIRSPSGHEEPCLLKRLSN
GHIGISFTPREVGEHLVSVKKNGRHVANSPFKILVGQQEIGDARKVKVKGTGLRESATFD
VAEFTVDTREAGYGGLGLSIEGPSKADINCRDNEDGTCTVTYRPTEPGNYIINIKFADQH
VPGSPFTVKVTGEGAGKHTEKITRKRQAASVATVGSTCDLNLKIPETSPFDLSAQVTSPS
GRTEDAEIVELENCTYSVRFVPAEMGIHTVSVRYKGQHVPGSPFQFTVGPLTEGGAGKVQ
AGGPGLERGEVGQLSEFTIWTREAGAGGLAIAVEGPAKAEINFEDRKDGSCGVSYMPTDP
GEYQVSIKFNDDHIPGSPFSVDVTPPMGDARQVSVSSLQETGLKLNQPASFAVQLNGARP
GDLQAQVIAPSGAQEECIITDVEEAGQYVVRFMPRENGVYTVHVTYNGVPIPGSPFRIRA
GSTLVEGDAGMVHAYGAGLEGGRTGERCEFIVNTINAGAGALAITVDGPSKVQLDCVECD
EGYKVTYIPRAPGDYNISVKYAGQNPIVGSPFRARITGPKMAGAVSGVHESCSVVVETVS
KSSAQASYAGGVQGMSRLLSDATKVKSQGMGLKKGFLGQKNSFNVDCGNAGTNMLMVGVH
GPRTPCEEVNVKHMGGQKYNVVYTVREKGDYELIVKWGDQHIPGSPFKVTVT
Download sequence
Identical sequences 7739.JGI132043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]