SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI148657 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI148657
Domain Number 1 Region: 4-216
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 4.58e-68
Family Fibrinogen C-terminal domain-like 0.00000415
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI148657
Sequence length 216
Comment (Branchiostoma floridae)
Sequence
GSDAPQDCADLYEDGIIESGINAVSDPRVFVYCDMRNHGGGWTLLQRRQNGSVDFAKNWA
DYEQGFGNLDGEHWLGLSKQNQITGQKTYSLRVDLGDWENQFRYATYNSFSVGGSSTNYQ
VSISSYSGDAGDSLASGGNRFSINGISFTTSDDNNGPNTANCAGNFGGGGWWFPDSCGRT
MLNGRYNDSRRAQGVHWDTWKGWSYTLKMTSLKVRP
Download sequence
Identical sequences 7739.JGI148657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]