SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI170045 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI170045
Domain Number 1 Region: 9-141
Classification Level Classification E-value
Superfamily TNF-like 1.08e-32
Family TNF-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI170045
Sequence length 144
Comment (Branchiostoma floridae)
Sequence
PPPGAFSAQPQSAFSAARQTKMYGSIPPQRIGFDKIFVNEGGDFHSGNGTFVTRVPGVYF
FTFTIQSYDGKFANIALVQNGREQVTLYTEDDDRNIMQSQSIMLHLATNDKVWLQLDGGT
HHAILSFHDNRITFSGYLVYAKLS
Download sequence
Identical sequences 7739.JGI170045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]