SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI190493 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI190493
Domain Number 1 Region: 2-92
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-31
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI190493
Sequence length 93
Comment (Branchiostoma floridae)
Sequence
LHYTNDQDCTWTITVTAGKFVHLLFTVFDIESDSACRFDSVTVYDGPSTSAPQLLKGCGD
RLPAPITSSSNTLTVRFVTDEDVVRMGFSASFS
Download sequence
Identical sequences C3YVU1
7739.JGI190493 XP_002599613.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]