SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI198966 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI198966
Domain Number 1 Region: 2-70
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.31e-21
Family Thyroglobulin type-1 domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI198966
Sequence length 79
Comment (Branchiostoma floridae)
Sequence
ETPCETARTTALNTNDTLTGGYVPTCSDTGAYMPVQCHGSTGECWCVDGQGQEVSGTRVG
AGYALPDCSGTKSLKPICS
Download sequence
Identical sequences C3ZSJ3
7739.JGI198966 XP_002588384.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]