SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI199747 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI199747
Domain Number 1 Region: 9-71
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.12e-16
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 
Domain Number 2 Region: 112-142
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000185
Family LIM domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI199747
Sequence length 143
Comment (Branchiostoma floridae)
Sequence
MSVQFSFALPFHRDFGSLSKENIRENNKLAFDVAEQELGIPSLLDPADMVALKVPDKLSI
MTYLSQLYNFFSGPGLGKNPVNPFPMQGLAVFIANGFDFDYRKLSESEVVQRSDKNCSVC
DKYVHIVEKVFVDGKMYHRNCFR
Download sequence
Identical sequences C3YWG0
7739.JGI199747 XP_002599192.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]