SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI205898 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  7739.JGI205898
Domain Number - Region: 3-64
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00334
Family Calponin-homology domain, CH-domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI205898
Sequence length 502
Comment (Branchiostoma floridae)
Sequence
MTEILCRWLNDEVKLSKPVDNKTFSKDFSNGYLIGELLARYQLQNDFDKFSQNRTAESKL
NNFTRLEPTLRLLEVDFDTNIAHSIMTEQHGVATRLLYQLFIGLGRKQKANLTGVAMETM
RPAAPVKLEGIESEIYKERLKILTPRQTDQNLGKLQARFDDKWARHEQTMFREKMEEEQR
YRRLQSEESQKAVEKARMARQKQTELLAKLRAATVEIPKPPPSKTLKAIKQRKEARRFKE
AEDTRVMIKDFENKLKSQQIATSGMDDGSSELAYSPGANDDYIGKIKRRLEEDSKAREER
EKRRRKVLVDQLKAHDAQEEAHREEMLVNRLMRQSQQERRIAVQLLQARHEKDIIRKNRI
FLEKQYDARRVKDFEDALNKEKELAQLAKLEYIEQTKAEQELHDRIAAERAEQRYRKHYD
MCMEVTLQIVDYATKFGEYRELTEKLVPPKLFREWTQLFIEGHPLYEERDPTAEGSEPTP
EQIIEMEKQKLLNDGDFKEYKV
Download sequence
Identical sequences C3YIE4
XP_002603866.1.56174 7739.JGI205898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]