SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI206646 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI206646
Domain Number 1 Region: 25-136
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.28e-31
Family Calponin-homology domain, CH-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI206646
Sequence length 146
Comment (Branchiostoma floridae)
Sequence
LTSPKNIDDMDPNFTIRRKLDIMREEMQAVEELRRNIESRLKVSLPDNLGTALMDGVVLC
HLANHVRPRSISSIHVPSPAVPKLSLAKCRRNVENFLEACRRIGVPNDQLCLPHDILEEK
GLARVGVTVHSLLNCAGQKTKQTSAV
Download sequence
Identical sequences C3ZFA6
XP_002593401.1.56174 7739.JGI206646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]