SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI212830 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI212830
Domain Number 1 Region: 2-223
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.9e-60
Family Calponin-homology domain, CH-domain 0.0000256
Further Details:      
 
Domain Number 2 Region: 968-1115
Classification Level Classification E-value
Superfamily Spectrin repeat 1.13e-28
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 3 Region: 509-653
Classification Level Classification E-value
Superfamily Spectrin repeat 1.71e-21
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 4 Region: 876-1016
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-21
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 5 Region: 330-437
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-18
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 6 Region: 771-904
Classification Level Classification E-value
Superfamily Spectrin repeat 8.9e-18
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 7 Region: 693-799
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-17
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 8 Region: 445-544
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000863
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number 9 Region: 1127-1260
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000617
Family Spectrin repeat 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI212830
Sequence length 1275
Comment (Branchiostoma floridae)
Sequence
ADEREDVQKKTFAKWINSQLSKVGGQQVRELFEDLKDGTKLLSLLEILCGTKLAREKGRM
RVHYLNNVNRALQVLDKHNVSLVKIWFLAGMTKRLAPMAGQDLISDPISSAVYNLQSKAE
QSNLEKTLLAWCRQTTQGYRSVDIVNFTSSWRDGYAFNALIHKYRPDLFDYNILSKMGTE
KRLEHAFKVANEHLNIDRLLDPEDVNVEIPDKKSIIMYVTLFFQVLPHQKITQEAMQEAL
EETEVLVDGTVTKTSTVTIQRNESQVVVKQEVVTTKVTQGQGQTTTKVKQQEVKQEVQVK
PEVHQLKQEVQQVKVTQPRISDISLSGVDLGAYQNALEEVLAWLLAAEEKLQHQGDISDL
VDDVKDQFHEHESFMMELTSHQSRVGSVLQAGNQLIMEGKITEDEENEIREQMSLLNSRW
EVLRVQSMDRQSKLHEVLMNLQQKQLDQLDAWLSGTEQRIKVMDTQGIGPDLDQVRRQVE
EHKTLQEGLETQQLQVNSLTHMVVVVDENSPENATQALEAQLQNLGERWAWVCKWTEDRW
MVLQEVLVRWQVFNLEQMDFHDWLTDKEGALQTMQHANLSDPNVIVAQVKKLKILEHEME
AKQPTFQVLSGKAAEVVQHLDRSSSAVEGIQGKIEEFTQRWDAIVQKMENYSKLMSASAA
VPKKTTTITETVTKMTQKLTQKTPPPPPPKKAVSQQRRRFDSEIATLLAWIDDTEALLLS
PAYTNPATSNSLQAQTDKFNQLDENIMSYQGRVQTIQETGETLIEEEDDKIQLETRLNTF
MERWNEICVLINDRKRKLQMARLCKQFYTELDVLRDVTGRKMTWLQGQDKPSDDAVKIKQ
QMDELQVEVTDMAAHSERVEQLNSLGSQLADSSDPPKNLQQDLTQFQLQWEELVAKMAAR
EKDLTKALEQAPPKQYLEAMKALTQWIDNVESLLTTEKFYIADIPTMKDQQQKFKEVQQA
LKDQQKSLDFVNTTGKQVVESSPPDRSRGLQKELNGLNERWSNVCAMTEDRLEHLDKGVE
LLTQFQKEGDGLRTWMDEVDVYIHSEEAAVGDTETLQAQLEQSKSLQKDIASLQHNMNNV
NEAGKRLVPEAHPDFSKKLKQELKDLNERWDAITKKKLKADLDKKEPDLKALNTVGNEMA
TKTGSPGGLGNDLQVVNERWTVLYNTVNKRYEVSQEVWTLWQQFHAVAIRTGTNVHSGIR
QFSSRIQALENHVRNHPSDNRDKIQEISQQLVEHKVLVEPVQTEVTTFTSRWDTLQQQVR
VQGHRTGYRRILVHD
Download sequence
Identical sequences 7739.JGI212830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]