SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI229025 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI229025
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily SRCR-like 5.62e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI229025
Sequence length 103
Comment (Branchiostoma floridae)
Sequence
LRLVGGSGAHEGRLEVRPQDSYVWGTVCDDRFDMDDADVACRMLGYSEATEVHSSAYFGE
GTGLIYMDDLQCTGDENSLFDCPYAGWEVHNCGHSEDVGIVCN
Download sequence
Identical sequences C3XYG8
XP_002610843.1.56174 7739.JGI229025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]