SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI235581 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI235581
Domain Number 1 Region: 6-86
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000389
Family Calponin-homology domain, CH-domain 0.0067
Further Details:      
 
Weak hits

Sequence:  7739.JGI235581
Domain Number - Region: 189-222
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0034
Family Trimerization domain of TRAF 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI235581
Sequence length 229
Comment (Branchiostoma floridae)
Sequence
MAGELDEESLQELYSWIDEIPLSRPKKNITRDFSDGVMAAEIIRHFQPRMVDLHNYSPAN
STQQKLSNWGTLNRKVFNKLNFQVPDDVMRAVCNCKPGVVEVVLNQLRLKIGAYMERRKK
SADVRQGFLNQTQSDMMPCLTQYGESQESIDKDIENETKLPSPIDSKDGLDPEVRLLLEE
KEQAFLASQETVHILNAKIRRLEHLLHLKDIRIEDLNRKLGQYSQNGHS
Download sequence
Identical sequences C3YJ05
7739.JGI235581 XP_002603656.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]