SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI243615 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI243615
Domain Number 1 Region: 123-188
Classification Level Classification E-value
Superfamily SNARE fusion complex 2.62e-19
Family SNARE fusion complex 0.00095
Further Details:      
 
Domain Number 2 Region: 3-119
Classification Level Classification E-value
Superfamily SNARE-like 8.24e-18
Family Synatpobrevin N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI243615
Sequence length 222
Comment (Branchiostoma floridae)
Sequence
MPILYSVVARGTTVLAKFASCAGNFSEVTEQILSRVSPENAKLTYSHGRACIPLSCKTKA
VGLVPFFLLQDFERSKAFMYLNEVKRRFQATYGARAQTALPFAMNSEFSRVLSTQMKHFS
ESKDVDRVSKVQGDLDELKGIMVKNIDSIAARGERLELLIDKTEDLEATSVTFKKTSKNL
ARSMCMKNLKLTVILAIVIILIIYFIVSAACGGLSWPCTRKT
Download sequence
Identical sequences 7739.JGI243615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]