SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI246248 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI246248
Domain Number 1 Region: 77-146
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.97e-23
Family Thyroglobulin type-1 domain 0.00075
Further Details:      
 
Domain Number 2 Region: 4-72
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.66e-21
Family Thyroglobulin type-1 domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI246248
Sequence length 154
Comment (Branchiostoma floridae)
Sequence
MSLELTPCQQENLEAVESELVGVYIPQCLEDGRYQPLQCHPSTGYCWCVDQYGDVVEDTE
LDRGMMPNCEVRHRMMKCETKCRQARLEAQASAMIGRYVPQCTEDGRYRPLQCHSSTGYC
WCVDELGETIEGTKAGPGMVPSCDEFLGNYGCFL
Download sequence
Identical sequences C3ZFN0
XP_002592627.1.56174 7739.JGI246248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]