SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI246512 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI246512
Domain Number 1 Region: 10-87
Classification Level Classification E-value
Superfamily NHL repeat 0.0000000000000288
Family NHL repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI246512
Sequence length 87
Comment (Branchiostoma floridae)
Sequence
MSKFGSIEGQAPEAVTVDKRGNIFIANWYNHRVLKYDKDGVYLSSFGSRGTGAGYLNGPS
GICVDSLGRVIVADSGNQRVEMFTAEG
Download sequence
Identical sequences C3ZHB4
7739.JGI246512 XP_002592086.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]