SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI254986 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI254986
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-32
Family Kringle modules 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI254986
Sequence length 84
Comment (Branchiostoma floridae)
Sequence
ECYTGKGKSYRGTTTLTWSGHTCQAWSSQTPHSHSYTPEKYPNAGLTNNYCRNPSKSDAP
WCYTTSSKRWAFCAIPKCMENEGT
Download sequence
Identical sequences 7739.JGI254986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]