SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI255934 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI255934
Domain Number 1 Region: 1-195
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.44e-55
Family Fibrinogen C-terminal domain-like 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI255934
Sequence length 199
Comment (Branchiostoma floridae)
Sequence
DCAHIHEQDPSKRSGLYSTMVPGMRTSVITYCDMDNNKEGGGWTVIQRRQTDDSFEKVWN
EYKHGFGNPMGTFWWGNEKVHQLTKQKPYHLRVEVQNAAGSKRVAVYEDFKLEDEDSKYT
LRVGKYSGTAGDALMTHNGKNPSGEQAWGDSNGVGFSANDKDNDGSKTSECGKQYQSGWW
FNQFCPNPANLNGKSTTLS
Download sequence
Identical sequences C3ZZQ9
7739.JGI255934 XP_002585958.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]